Brand: | Abnova |
Reference: | H00138474-M01 |
Product name: | TAF1L monoclonal antibody (M01), clone 1E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF1L. |
Clone: | 1E12 |
Isotype: | IgG2a Kappa |
Gene id: | 138474 |
Gene name: | TAF1L |
Gene alias: | MGC134910|TAF2A2 |
Gene description: | TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like |
Genbank accession: | NM_153809 |
Immunogen: | TAF1L (NP_722516, 1532 a.a. ~ 1641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK |
Protein accession: | NP_722516 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TAF1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |