C9orf115 purified MaxPab mouse polyclonal antibody (B01P) View larger

C9orf115 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C9orf115 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C9orf115 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00138428-B01P
Product name: C9orf115 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C9orf115 protein.
Gene id: 138428
Gene name: PTRH1
Gene alias: C9orf115|MGC51999|PTH1
Gene description: peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
Genbank accession: NM_001002913
Immunogen: C9orf115 (NP_001002913, 1 a.a. ~ 214 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGPSLGP
Protein accession: NP_001002913
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00138428-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C9orf115 expression in transfected 293T cell line by C9orf115 MaxPab polyclonal antibody.

Lane 1: C9orf115 transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C9orf115 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart