UNC5D monoclonal antibody (M01), clone 4G3 View larger

UNC5D monoclonal antibody (M01), clone 4G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNC5D monoclonal antibody (M01), clone 4G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UNC5D monoclonal antibody (M01), clone 4G3

Brand: Abnova
Reference: H00137970-M01
Product name: UNC5D monoclonal antibody (M01), clone 4G3
Product description: Mouse monoclonal antibody raised against a partial recombinant UNC5D.
Clone: 4G3
Isotype: IgG2a Kappa
Gene id: 137970
Gene name: UNC5D
Gene alias: FLJ16019|KIAA1777|PRO34692|Unc5h4
Gene description: unc-5 homolog D (C. elegans)
Genbank accession: NM_080872
Immunogen: UNC5D (NP_543148, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQ
Protein accession: NP_543148
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00137970-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00137970-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged UNC5D is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UNC5D monoclonal antibody (M01), clone 4G3 now

Add to cart