Brand: | Abnova |
Reference: | H00136991-A01 |
Product name: | ASZ1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ASZ1. |
Gene id: | 136991 |
Gene name: | ASZ1 |
Gene alias: | ALP1|ANKL1|C7orf7|GASZ|MGC26634|Orf3 |
Gene description: | ankyrin repeat, SAM and basic leucine zipper domain containing 1 |
Genbank accession: | NM_130768 |
Immunogen: | ASZ1 (NP_570124, 127 a.a. ~ 234 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLL |
Protein accession: | NP_570124 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ASZ1 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of ASZ1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |