Brand: | Abnova |
Reference: | H00136371-M02 |
Product name: | ASB10 monoclonal antibody (M02), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASB10. |
Clone: | 1F3 |
Isotype: | IgG2a Kappa |
Gene id: | 136371 |
Gene name: | ASB10 |
Gene alias: | - |
Gene description: | ankyrin repeat and SOCS box-containing 10 |
Genbank accession: | NM_001142459 |
Immunogen: | ASB10 (NP_001135931, 48 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW |
Protein accession: | NP_001135931 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | ASB10 monoclonal antibody (M02), clone 1F3 Western Blot analysis of ASB10 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |