MTPN monoclonal antibody (M14), clone 1F3 View larger

MTPN monoclonal antibody (M14), clone 1F3

H00136319-M14_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTPN monoclonal antibody (M14), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about MTPN monoclonal antibody (M14), clone 1F3

Brand: Abnova
Reference: H00136319-M14
Product name: MTPN monoclonal antibody (M14), clone 1F3
Product description: Mouse monoclonal antibody raised against a full-length recombinant MTPN.
Clone: 1F3
Isotype: IgG2a Kappa
Gene id: 136319
Gene name: MTPN
Gene alias: FLJ31098|FLJ99857|GCDP|V-1
Gene description: myotrophin
Genbank accession: BC028093
Immunogen: MTPN (AAH28093, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Protein accession: AAH28093
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00136319-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00136319-M14-13-15-1.jpg
Application image note: Western Blot analysis of MTPN expression in transfected 293T cell line by MTPN monoclonal antibody (M14), clone 1F3.

Lane 1: MTPN transfected lysate(12.9 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MTPN monoclonal antibody (M14), clone 1F3 now

Add to cart