Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00136319-M14 |
Product name: | MTPN monoclonal antibody (M14), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MTPN. |
Clone: | 1F3 |
Isotype: | IgG2a Kappa |
Gene id: | 136319 |
Gene name: | MTPN |
Gene alias: | FLJ31098|FLJ99857|GCDP|V-1 |
Gene description: | myotrophin |
Genbank accession: | BC028093 |
Immunogen: | MTPN (AAH28093, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
Protein accession: | AAH28093 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MTPN expression in transfected 293T cell line by MTPN monoclonal antibody (M14), clone 1F3. Lane 1: MTPN transfected lysate(12.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |