Cart 9 Product Products 2 358,56 € (empty)
-
1 x DCAMKL2...259,07 € -
1 x WAVE2...259,07 € -
1 x mPRγ...259,07 € -
1 x RFC1...259,07 € -
1 x Rubisco...259,07 € -
1 x EAR2...259,07 € -
1 x hCAP-G2...259,07 € -
1 x RUNX1...259,07 € -
No products
To be determined Shipping
2 358,56 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 358,56 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 358,56 €
Data sheet of PACRG purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about PACRG purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00135138-D01P |
| Product name: | PACRG purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PACRG protein. |
| Gene id: | 135138 |
| Gene name: | PACRG |
| Gene alias: | FLJ32724|GLUP|HAK005771|PARK2CRG|RP3-495O10.2 |
| Gene description: | PARK2 co-regulated |
| Genbank accession: | BC044227.1 |
| Immunogen: | PACRG (NP_001073847.1, 1 a.a. ~ 257 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN |
| Protein accession: | NP_001073847.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | PACRG MaxPab rabbit polyclonal antibody. Western Blot analysis of PACRG expression in human liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |