Cart 9 Product Products 2 358,56 € (empty)
-
1 x DCAMKL2...259,07 € -
1 x WAVE2...259,07 € -
1 x mPRγ...259,07 € -
1 x RFC1...259,07 € -
1 x Rubisco...259,07 € -
1 x EAR2...259,07 € -
1 x hCAP-G2...259,07 € -
1 x RUNX1...259,07 € -
No products
To be determined Shipping
2 358,56 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 358,56 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 358,56 €
Data sheet of UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00134510-B01P |
| Product name: | UBLCP1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human UBLCP1 protein. |
| Gene id: | 134510 |
| Gene name: | UBLCP1 |
| Gene alias: | CPUB1|FLJ25267|MGC10067 |
| Gene description: | ubiquitin-like domain containing CTD phosphatase 1 |
| Genbank accession: | NM_145049 |
| Immunogen: | UBLCP1 (NP_659486, 1 a.a. ~ 318 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLGDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ |
| Protein accession: | NP_659486 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of UBLCP1 expression in transfected 293T cell line (H00134510-T01) by UBLCP1 MaxPab polyclonal antibody. Lane 1: UBLCP1 transfected lysate(34.98 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |