View larger

TMEM171 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of TMEM171 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00134285-B01P
Product name:	TMEM171 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human TMEM171 protein.
Gene id:	134285
Gene name:	TMEM171
Gene alias:	PRP2
Gene description:	transmembrane protein 171
Genbank accession:	BC035310
Immunogen:	TMEM171 (AAH35310.1, 1 a.a. ~ 323 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MSPAAAAEPDGDQQDRHVSKLIFCFFVFGAVLLCVGVLLSIFGFQACQYKPLPDCPMVLKVAGPACAVVGLGAVILARSRAQLQLRAGLQRGQQMDPDRAFICGESRQFAQCLIFGFLFLTSGMLISVLGIWVPGCGSNWAQEPLNETDTGDSEPRMCGFLSLQIMGPLIVLVGLCFFVVAHVKKRNTLNAGQDASEREEGQIQIMEPVQVTVGDSVIIFPPPPPPYFPESSASAVAESPGTNSLLPNENPPSYYSIFNYGTPTSEGAASERDCESIYTISGTNSSSEASHTPHLPSELPPRYEEKENAAATFLPLSSEPSSP
Protein accession:	AAH35310.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of TMEM171 expression in transfected 293T cell line (H00134285-T02) by TMEM171 MaxPab polyclonal antibody. Lane 1: PRP2 transfected lysate(35.53 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice