PRP2 MaxPab mouse polyclonal antibody (B01) View larger

PRP2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRP2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PRP2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00134285-B01
Product name: PRP2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PRP2 protein.
Gene id: 134285
Gene name: TMEM171
Gene alias: PRP2
Gene description: transmembrane protein 171
Genbank accession: BC035310
Immunogen: PRP2 (AAH35310, 1 a.a. ~ 323 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSPAAAAEPDGDQQDRHVSKLIFCFFVFGAVLLCVGVLLSIFGFQACQYKPLPDCPMVLKVAGPACAVVGLGAVILARSRAQLQLRAGLQRGQQMDPDRAFICGESRQFAQCLIFGFLFLTSGMLISVLGIWVPGCGSNWAQEPLNETDTGDSEPRMCGFLSLQIMGPLIVLVGLCFFVVAHVKKRNTLNAGQDASEREEGQIQIMEPVQVTVGDSVIIFPPPPPPYFPESSASAVAESPGTNSLLPNENPPSYYSIFNYGTPTSEGAASERDCESIYTISGTNSSSEASHTPHLPSELPPRYEEKENAAATFLPLSSEPSSP
Protein accession: AAH35310
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00134285-B01-13-15-1.jpg
Application image note: Western Blot analysis of TMEM171 expression in transfected 293T cell line (H00134285-T01) by TMEM171 MaxPab polyclonal antibody.

Lane 1: PRP2 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRP2 MaxPab mouse polyclonal antibody (B01) now

Add to cart