Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FLJ25680 monoclonal antibody (M01), clone 3E3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about FLJ25680 monoclonal antibody (M01), clone 3E3
| Brand: | Abnova |
| Reference: | H00134187-M01 |
| Product name: | FLJ25680 monoclonal antibody (M01), clone 3E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ25680. |
| Clone: | 3E3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 134187 |
| Gene name: | POU5F2 |
| Gene alias: | DKFZp686P02123|FLJ25680|SPRM-1 |
| Gene description: | POU domain class 5, transcription factor 2 |
| Genbank accession: | NM_153216 |
| Immunogen: | FLJ25680 (NP_694948.1, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGAL |
| Protein accession: | NP_694948.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged POU5F2 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |