LOC134145 purified MaxPab mouse polyclonal antibody (B01P) View larger

LOC134145 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC134145 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LOC134145 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00134145-B01P
Product name: LOC134145 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LOC134145 protein.
Gene id: 134145
Gene name: FAM173B
Gene alias: FLJ20667
Gene description: family with sequence similarity 173, member B
Genbank accession: NM_199133
Immunogen: LOC134145 (NP_954584, 1 a.a. ~ 233 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATMKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA
Protein accession: NP_954584
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00134145-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LOC134145 expression in transfected 293T cell line by LOC134145 MaxPab polyclonal antibody.

Lane 1: LOC134145 transfected lysate(25.63 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC134145 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart