H1FOO MaxPab mouse polyclonal antibody (B01) View larger

H1FOO MaxPab mouse polyclonal antibody (B01)

H00132243-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of H1FOO MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about H1FOO MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00132243-B01
Product name: H1FOO MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human H1FOO protein.
Gene id: 132243
Gene name: H1FOO
Gene alias: MGC50807|osH1
Gene description: H1 histone family, member O, oocyte-specific
Genbank accession: BC047943
Immunogen: H1FOO (AAH47943, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA
Protein accession: AAH47943
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00132243-B01-13-15-1.jpg
Application image note: Western Blot analysis of H1FOO expression in transfected 293T cell line (H00132243-T01) by H1FOO MaxPab polyclonal antibody.

Lane 1: H1FOO transfected lysate(22.77 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy H1FOO MaxPab mouse polyclonal antibody (B01) now

Add to cart