IQCF1 monoclonal antibody (M01), clone 1H4 View larger

IQCF1 monoclonal antibody (M01), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IQCF1 monoclonal antibody (M01), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about IQCF1 monoclonal antibody (M01), clone 1H4

Brand: Abnova
Reference: H00132141-M01
Product name: IQCF1 monoclonal antibody (M01), clone 1H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant IQCF1.
Clone: 1H4
Isotype: IgG1 Kappa
Gene id: 132141
Gene name: IQCF1
Gene alias: FLJ27508|MGC39725
Gene description: IQ motif containing F1
Genbank accession: NM_152397.1
Immunogen: IQCF1 (NP_689610.1, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDTVATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE
Protein accession: NP_689610.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00132141-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00132141-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IQCF1 is 0.3 ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IQCF1 monoclonal antibody (M01), clone 1H4 now

Add to cart