METTL6 purified MaxPab rabbit polyclonal antibody (D01P) View larger

METTL6 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of METTL6 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about METTL6 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00131965-D01P
Product name: METTL6 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human METTL6 protein.
Gene id: 131965
Gene name: METTL6
Gene alias: MGC24132
Gene description: methyltransferase like 6
Genbank accession: BC022400.1
Immunogen: METTL6 (AAH22400.1, 1 a.a. ~ 255 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGL
Protein accession: AAH22400.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00131965-D01P-13-15-1.jpg
Application image note: Western Blot analysis of METTL6 expression in transfected 293T cell line (H00131965-T01) by METTL6 MaxPab polyclonal antibody.

Lane 1: METTL6 transfected lysate(30.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy METTL6 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart