Brand: | Abnova |
Reference: | H00131890-M03 |
Product name: | GRK7 monoclonal antibody (M03), clone 4C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRK7. |
Clone: | 4C6 |
Isotype: | IgG2b Kappa |
Gene id: | 131890 |
Gene name: | GRK7 |
Gene alias: | GPRK7 |
Gene description: | G protein-coupled receptor kinase 7 |
Genbank accession: | NM_139209 |
Immunogen: | GRK7 (NP_631948, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGP |
Protein accession: | NP_631948 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |