GRK7 monoclonal antibody (M03), clone 4C6 View larger

GRK7 monoclonal antibody (M03), clone 4C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRK7 monoclonal antibody (M03), clone 4C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about GRK7 monoclonal antibody (M03), clone 4C6

Brand: Abnova
Reference: H00131890-M03
Product name: GRK7 monoclonal antibody (M03), clone 4C6
Product description: Mouse monoclonal antibody raised against a partial recombinant GRK7.
Clone: 4C6
Isotype: IgG2b Kappa
Gene id: 131890
Gene name: GRK7
Gene alias: GPRK7
Gene description: G protein-coupled receptor kinase 7
Genbank accession: NM_139209
Immunogen: GRK7 (NP_631948, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGP
Protein accession: NP_631948
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy GRK7 monoclonal antibody (M03), clone 4C6 now

Add to cart