Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GPR175 monoclonal antibody (M01), clone 6D7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about GPR175 monoclonal antibody (M01), clone 6D7
| Brand: | Abnova |
| Reference: | H00131601-M01 |
| Product name: | GPR175 monoclonal antibody (M01), clone 6D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GPR175. |
| Clone: | 6D7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 131601 |
| Gene name: | GPR175 |
| Gene alias: | FLJ32197|TPRA40 |
| Gene description: | G protein-coupled receptor 175 |
| Genbank accession: | NM_016372 |
| Immunogen: | GPR175 (NP_057456, 281 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI |
| Protein accession: | NP_057456 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GPR175 expression in transfected 293T cell line by GPR175 monoclonal antibody (M01), clone 6D7. Lane 1: GPR175 transfected lysate(41.053 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |