ZPLD1 monoclonal antibody (M01), clone 1D8 View larger

ZPLD1 monoclonal antibody (M01), clone 1D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZPLD1 monoclonal antibody (M01), clone 1D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZPLD1 monoclonal antibody (M01), clone 1D8

Brand: Abnova
Reference: H00131368-M01
Product name: ZPLD1 monoclonal antibody (M01), clone 1D8
Product description: Mouse monoclonal antibody raised against a partial recombinant ZPLD1.
Clone: 1D8
Isotype: IgG2a Kappa
Gene id: 131368
Gene name: ZPLD1
Gene alias: -
Gene description: zona pellucida-like domain containing 1
Genbank accession: NM_175056
Immunogen: ZPLD1 (NP_778226, 244 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTW
Protein accession: NP_778226
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00131368-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00131368-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ZPLD1 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZPLD1 monoclonal antibody (M01), clone 1D8 now

Add to cart