Cart 124 Product Products 48 657,37 € (empty)
No products
To be determined Shipping
48 657,37 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 124 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 48 657,37 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 48 657,37 €
Data sheet of DNAJC19 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about DNAJC19 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00131118-B01P |
| Product name: | DNAJC19 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human DNAJC19 protein. |
| Gene id: | 131118 |
| Gene name: | DNAJC19 |
| Gene alias: | TIM14|TIMM14 |
| Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 19 |
| Genbank accession: | NM_145261.2 |
| Immunogen: | DNAJC19 (NP_660304.1, 1 a.a. ~ 116 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
| Protein accession: | NP_660304.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DNAJC19 expression in transfected 293T cell line (H00131118-T01) by DNAJC19 MaxPab polyclonal antibody. Lane1:DNAJC19 transfected lysate(12.76 KDa). Lane2:Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |