Brand: | Abnova |
Reference: | H00130507-M01 |
Product name: | ZNF650 monoclonal antibody (M01), clone 5A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF650. |
Clone: | 5A10 |
Isotype: | IgG1 Kappa |
Gene id: | 130507 |
Gene name: | UBR3 |
Gene alias: | DKFZp434P117|DKFZp686N10185|FLJ37422|KIAA2024|MGC126489|ZNF650 |
Gene description: | ubiquitin protein ligase E3 component n-recognin 3 (putative) |
Genbank accession: | NM_172070 |
Immunogen: | ZNF650 (NP_742067, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEFASRQKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSEDRPTGLVVLL |
Protein accession: | NP_742067 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ZNF650 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |