Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of OSR1 monoclonal antibody (M10), clone 1G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about OSR1 monoclonal antibody (M10), clone 1G9
| Brand: | Abnova |
| Reference: | H00130497-M10 |
| Product name: | OSR1 monoclonal antibody (M10), clone 1G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OSR1. |
| Clone: | 1G9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 130497 |
| Gene name: | OSR1 |
| Gene alias: | ODD |
| Gene description: | odd-skipped related 1 (Drosophila) |
| Genbank accession: | NM_145260 |
| Immunogen: | OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP |
| Protein accession: | NP_660303 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged OSR1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Metformin increases urinary sodium excretion by reducing phosphorylation of the sodium- chloride cotransporter.Hashimoto H, Nomura N, Shoda W, Isobe K, Kikuchi H, Yamamoto K, Fujimaru T, Ando F, Mori T, Okado T, Rai T, Uchida S, Sohara E. Metabolism. 2018 Mar 3. [Epub ahead of print] |