Reference: | H00130497-M08J |
Product name: | OSR1 monoclonal antibody (M08J), clone 4B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OSR1. |
Clone: | 4B12 |
Isotype: | IgG2b Kappa |
Gene id: | 130497 |
Gene name: | OSR1 |
Gene alias: | ODD |
Gene description: | odd-skipped related 1 (Drosophila) |
Genbank accession: | NM_145260 |
Immunogen: | OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP |
Protein accession: | NP_660303 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |