LOC129530 purified MaxPab mouse polyclonal antibody (B01P) View larger

LOC129530 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC129530 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LOC129530 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00129530-B01P
Product name: LOC129530 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LOC129530 protein.
Gene id: 129530
Gene name: LYG1
Gene alias: SALW1939
Gene description: lysozyme G-like 1
Genbank accession: NM_174898.1
Immunogen: LOC129530 (NP_777558.1, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF
Protein accession: NP_777558.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00129530-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LYG1 expression in transfected 293T cell line (H00129530-T01) by LYG1 MaxPab polyclonal antibody.

Lane 1: LOC129530 transfected lysate(21.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC129530 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart