Brand: | Abnova |
Reference: | H00128434-M01 |
Product name: | C20orf102 monoclonal antibody (M01), clone 3B9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant C20orf102. |
Clone: | 3B9 |
Isotype: | IgG1 Kappa |
Gene id: | 128434 |
Gene name: | VSTM2L |
Gene alias: | C20orf102|dJ1118M15.2 |
Gene description: | V-set and transmembrane domain containing 2 like |
Genbank accession: | BC033818 |
Immunogen: | C20orf102 (AAH33818.1, 25 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL |
Protein accession: | AAH33818.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | C20orf102 monoclonal antibody (M01), clone 3B9 Western Blot analysis of C20orf102 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |