APOA1BP MaxPab mouse polyclonal antibody (B01) View larger

APOA1BP MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOA1BP MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about APOA1BP MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00128240-B01
Product name: APOA1BP MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human APOA1BP protein.
Gene id: 128240
Gene name: APOA1BP
Gene alias: AIBP|MGC119143|MGC119144|MGC119145|YJEFN1
Gene description: apolipoprotein A-I binding protein
Genbank accession: BC100932
Immunogen: APOA1BP (AAI00933, 1 a.a. ~ 185 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ
Protein accession: AAI00933
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00128240-B01-13-15-1.jpg
Application image note: Western Blot analysis of APOA1BP expression in transfected 293T cell line (H00128240-T01) by APOA1BP MaxPab polyclonal antibody.

Lane 1: APOA1BP transfected lysate(20.35 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy APOA1BP MaxPab mouse polyclonal antibody (B01) now

Add to cart