Brand: | Abnova |
Reference: | H00127933-A01 |
Product name: | UHMK1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant UHMK1. |
Gene id: | 127933 |
Gene name: | UHMK1 |
Gene alias: | KIS|Kist |
Gene description: | U2AF homology motif (UHM) kinase 1 |
Genbank accession: | BC026046 |
Immunogen: | UHMK1 (AAH26046, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVP |
Protein accession: | AAH26046 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |