Brand: | Abnova |
Reference: | H00127833-M01 |
Product name: | SYT2 monoclonal antibody (M01), clone 1G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYT2. |
Clone: | 1G10 |
Isotype: | IgG2a Kappa |
Gene id: | 127833 |
Gene name: | SYT2 |
Gene alias: | SytII |
Gene description: | synaptotagmin II |
Genbank accession: | NM_177402 |
Immunogen: | SYT2 (NP_796376, 311 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKN |
Protein accession: | NP_796376 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SYT2 is approximately 0.1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |