GJB4 monoclonal antibody (M01), clone 1E3-1C12 View larger

GJB4 monoclonal antibody (M01), clone 1E3-1C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GJB4 monoclonal antibody (M01), clone 1E3-1C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about GJB4 monoclonal antibody (M01), clone 1E3-1C12

Brand: Abnova
Reference: H00127534-M01
Product name: GJB4 monoclonal antibody (M01), clone 1E3-1C12
Product description: Mouse monoclonal antibody raised against a full length recombinant GJB4.
Clone: 1E3-1C12
Isotype: IgG2a kappa
Gene id: 127534
Gene name: GJB4
Gene alias: CX30.3|EKV|MGC21116
Gene description: gap junction protein, beta 4, 30.3kDa
Genbank accession: BC034709
Immunogen: GJB4 (AAH34709, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
Protein accession: AAH34709
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00127534-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00127534-M01-1-1-1.jpg
Application image note: GJB4 monoclonal antibody (M01), clone 1E3-1C12 Western Blot analysis of GJB4 expression in Hela ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GJB4 monoclonal antibody (M01), clone 1E3-1C12 now

Add to cart