DMBX1 monoclonal antibody (M01), clone 1A9 View larger

DMBX1 monoclonal antibody (M01), clone 1A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DMBX1 monoclonal antibody (M01), clone 1A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about DMBX1 monoclonal antibody (M01), clone 1A9

Brand: Abnova
Reference: H00127343-M01
Product name: DMBX1 monoclonal antibody (M01), clone 1A9
Product description: Mouse monoclonal antibody raised against a partial recombinant DMBX1.
Clone: 1A9
Isotype: IgG2a Kappa
Gene id: 127343
Gene name: DMBX1
Gene alias: MBX|OTX3|PAXB
Gene description: diencephalon/mesencephalon homeobox 1
Genbank accession: NM_147192
Immunogen: DMBX1 (NP_671725, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEK
Protein accession: NP_671725
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy DMBX1 monoclonal antibody (M01), clone 1A9 now

Add to cart