ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P) View larger

ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00127124-B01P
Product name: ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ATP6V1G3 protein.
Gene id: 127124
Gene name: ATP6V1G3
Gene alias: ATP6G3|MGC119810|MGC119813|Vma10
Gene description: ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
Genbank accession: NM_133262.2
Immunogen: ATP6V1G3 (NP_573569.1, 1 a.a. ~ 118 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Protein accession: NP_573569.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00127124-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ATP6V1G3 expression in transfected 293T cell line (H00127124-T01) by ATP6V1G3 MaxPab polyclonal antibody.

Lane 1: ATP6V1G3 transfected lysate(12.98 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart