Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 278,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 278,00 €
Data sheet of FLJ39501 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about FLJ39501 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00126410-B01P |
| Product name: | FLJ39501 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FLJ39501 protein. |
| Gene id: | 126410 |
| Gene name: | CYP4F22 |
| Gene alias: | FLJ39501|LI3 |
| Gene description: | cytochrome P450, family 4, subfamily F, polypeptide 22 |
| Genbank accession: | BC069351 |
| Immunogen: | FLJ39501 (AAH69351, 1 a.a. ~ 531 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA |
| Protein accession: | AAH69351 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CYP4F22 expression in transfected 293T cell line (H00126410-T01) by CYP4F22 MaxPab polyclonal antibody. Lane 1: FLJ39501 transfected lysate(58.41 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | CYP4F22 is highly expressed at the site and timing of onset of keratinization during skin development.Sasaki K, Akiyama M, Yanagi T, Sakai K, Miyamura Y, Sato M, Shimizu H. J Dermatol Sci. 2011 Dec 13. |