JSRP1 monoclonal antibody (M02), clone 6A9 View larger

JSRP1 monoclonal antibody (M02), clone 6A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JSRP1 monoclonal antibody (M02), clone 6A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about JSRP1 monoclonal antibody (M02), clone 6A9

Brand: Abnova
Reference: H00126306-M02
Product name: JSRP1 monoclonal antibody (M02), clone 6A9
Product description: Mouse monoclonal antibody raised against a partial recombinant JSRP1.
Clone: 6A9
Isotype: IgG2a Kappa
Gene id: 126306
Gene name: JSRP1
Gene alias: FLJ32416|JP-45
Gene description: junctional sarcoplasmic reticulum protein 1
Genbank accession: NM_144616
Immunogen: JSRP1 (NP_653217.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT
Protein accession: NP_653217.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00126306-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00126306-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged JSRP1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy JSRP1 monoclonal antibody (M02), clone 6A9 now

Add to cart