ZNF428 monoclonal antibody (M01), clone 3H4 View larger

ZNF428 monoclonal antibody (M01), clone 3H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF428 monoclonal antibody (M01), clone 3H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF428 monoclonal antibody (M01), clone 3H4

Brand: Abnova
Reference: H00126299-M01
Product name: ZNF428 monoclonal antibody (M01), clone 3H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant ZNF428.
Clone: 3H4
Isotype: IgG2a Kappa
Gene id: 126299
Gene name: ZNF428
Gene alias: C19orf37|MGC51082|Zfp428
Gene description: zinc finger protein 428
Genbank accession: NM_182498.2
Immunogen: ZNF428 (NP_872304.2, 1 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPEYDPGYKVKQRLGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPRAGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELHGHFMLHARGEV
Protein accession: NP_872304.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00126299-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00126299-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF428 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF428 monoclonal antibody (M01), clone 3H4 now

Add to cart