NTN5 MaxPab mouse polyclonal antibody (B01) View larger

NTN5 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NTN5 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about NTN5 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00126147-B01
Product name: NTN5 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NTN5 protein.
Gene id: 126147
Gene name: NTN5
Gene alias: -
Gene description: netrin 5
Genbank accession: NM_145807.1
Immunogen: NTN5 (NP_665806.1, 1 a.a. ~ 489 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSPGNHLGARETCNGSLTLALGGPFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPGALGGPERVTFHSTPGPKATVAASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATGGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQDAWVPRADLTCGCLRLQPGTDYLLLGSAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCRGVRAPTPSPRPEH
Protein accession: NP_665806.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00126147-B01-13-15-1.jpg
Application image note: Western Blot analysis of NTN5 expression in transfected 293T cell line (H00126147-T01) by NTN5 MaxPab polyclonal antibody.

Lane 1: NTN5 transfected lysate(53.79 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NTN5 MaxPab mouse polyclonal antibody (B01) now

Add to cart