Brand: | Abnova |
Reference: | H00125972-D01 |
Product name: | CALR3 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CALR3 protein. |
Gene id: | 125972 |
Gene name: | CALR3 |
Gene alias: | CRT2|FLJ25355|MGC26577 |
Gene description: | calreticulin 3 |
Genbank accession: | NM_145046.2 |
Immunogen: | CALR3 (NP_659483.1, 1 a.a. ~ 384 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL |
Protein accession: | NP_659483.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | CALR3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CALR3 expression in mouse lung. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |