Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00125965-B01P |
Product name: | COX6B2 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human COX6B2 protein. |
Gene id: | 125965 |
Gene name: | COX6B2 |
Gene alias: | COXVIB2|MGC119094 |
Gene description: | cytochrome c oxidase subunit VIb polypeptide 2 (testis) |
Genbank accession: | NM_144613.4 |
Immunogen: | COX6B2 (NP_653214.2, 1 a.a. ~ 88 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI |
Protein accession: | NP_653214.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of COX6B2 expression in transfected 293T cell line (H00125965-T01) by COX6B2 MaxPab polyclonal antibody. Lane1:COX6B2 transfected lysate(9.68 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |