MGC33839 purified MaxPab mouse polyclonal antibody (B01P) View larger

MGC33839 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC33839 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MGC33839 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00125875-B01P
Product name: MGC33839 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MGC33839 protein.
Gene id: 125875
Gene name: CLDND2
Gene alias: MGC33839
Gene description: claudin domain containing 2
Genbank accession: NM_152353
Immunogen: MGC33839 (NP_689566, 1 a.a. ~ 167 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL
Protein accession: NP_689566
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00125875-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MGC33839 expression in transfected 293T cell line by MGC33839 MaxPab polyclonal antibody.

Lane 1: MGC33839 transfected lysate(18.37 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGC33839 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart