C17orf49 purified MaxPab mouse polyclonal antibody (B01P) View larger

C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00124944-B01P
Product name: C17orf49 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C17orf49 protein.
Gene id: 124944
Gene name: C17orf49
Gene alias: MGC49942
Gene description: chromosome 17 open reading frame 49
Genbank accession: NM_174893
Immunogen: C17orf49 (NP_777553.1, 1 a.a. ~ 172 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA
Protein accession: NP_777553.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00124944-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C17orf49 expression in transfected 293T cell line (H00124944-T02) by C17orf49 MaxPab polyclonal antibody.

Lane 1: C17orf49 transfected lysate(18.92 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C17orf49 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart