USP43 monoclonal antibody (M01), clone 1A5 View larger

USP43 monoclonal antibody (M01), clone 1A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP43 monoclonal antibody (M01), clone 1A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about USP43 monoclonal antibody (M01), clone 1A5

Brand: Abnova
Reference: H00124739-M01
Product name: USP43 monoclonal antibody (M01), clone 1A5
Product description: Mouse monoclonal antibody raised against a partial recombinant USP43.
Clone: 1A5
Isotype: IgG2a Kappa
Gene id: 124739
Gene name: USP43
Gene alias: FLJ30626
Gene description: ubiquitin specific peptidase 43
Genbank accession: XM_371015
Immunogen: USP43 (NP_055881, 315 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEEGGVPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIR
Protein accession: NP_055881
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00124739-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00124739-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged USP43 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP43 monoclonal antibody (M01), clone 1A5 now

Add to cart