CANT1 monoclonal antibody (M01), clone 2D3 View larger

CANT1 monoclonal antibody (M01), clone 2D3

H00124583-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CANT1 monoclonal antibody (M01), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CANT1 monoclonal antibody (M01), clone 2D3

Brand: Abnova
Reference: H00124583-M01
Product name: CANT1 monoclonal antibody (M01), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant CANT1.
Clone: 2D3
Isotype: IgG2a Kappa
Gene id: 124583
Gene name: CANT1
Gene alias: SCAN-1|SHAPY
Gene description: calcium activated nucleotidase 1
Genbank accession: BC017655
Immunogen: CANT1 (AAH17655, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI
Protein accession: AAH17655
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00124583-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00124583-M01-1-4-1.jpg
Application image note: CANT1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of CANT1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: ERG rearrangement in small cell prostatic and lung cancer.Scheble VJ, Braun M, Wilbertz T, Stiedl AC, Petersen K, Schilling D, Reischl M, Seitz G, Fend F, Kristiansen G, Perner S.
Histopathology. 2010 Jun;56(7):937-43.

Reviews

Buy CANT1 monoclonal antibody (M01), clone 2D3 now

Add to cart