MSI2 monoclonal antibody (M19), clone 1F2 View larger

MSI2 monoclonal antibody (M19), clone 1F2

H00124540-M19_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSI2 monoclonal antibody (M19), clone 1F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MSI2 monoclonal antibody (M19), clone 1F2

Brand: Abnova
Reference: H00124540-M19
Product name: MSI2 monoclonal antibody (M19), clone 1F2
Product description: Mouse monoclonal antibody raised against a partial recombinant MSI2.
Clone: 1F2
Isotype: IgG2b Lambda
Gene id: 124540
Gene name: MSI2
Gene alias: FLJ36569|MGC3245|MSI2H
Gene description: musashi homolog 2 (Drosophila)
Genbank accession: NM_138962
Immunogen: MSI2 (NP_620412, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHE
Protein accession: NP_620412
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00124540-M19-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MSI2 monoclonal antibody (M19), clone 1F2 now

Add to cart