Cart 20 Product Products 8 768,00 € (empty)
No products
To be determined Shipping
8 768,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 20 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 768,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 768,00 €
Data sheet of MGC33367 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MGC33367 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00123970-B01P |
| Product name: | MGC33367 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MGC33367 protein. |
| Gene id: | 123970 |
| Gene name: | C16orf78 |
| Gene alias: | MGC33367 |
| Gene description: | chromosome 16 open reading frame 78 |
| Genbank accession: | BC021181 |
| Immunogen: | MGC33367 (AAH21181, 1 a.a. ~ 265 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSEQQMDLKDLMPTKRKYMWKTAEDRRMSDLTCVLEWLERRQGKKKQAPEKQKPKVVTVLKRNKKKEEKKGKGLMTARGGNRRDTETSQQALGKRFRKDAASYRSLYGVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVLDPMLQEGTFNSQRATFIRDWSNKMPDMAYERKLKSLMEKSTEPKMETMRMLKPEEVLSCRYLRLSKENIRTLLKLCKDAGMNVDIHPHMVEEDIDAKKVFTGIPSMAL |
| Protein accession: | AAH21181 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C16orf78 expression in transfected 293T cell line (H00123970-T01) by C16orf78 MaxPab polyclonal antibody. Lane 1: MGC33367 transfected lysate(29.26 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |