NTAN1 MaxPab mouse polyclonal antibody (B01) View larger

NTAN1 MaxPab mouse polyclonal antibody (B01)

H00123803-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NTAN1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NTAN1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00123803-B01
Product name: NTAN1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NTAN1 protein.
Gene id: 123803
Gene name: NTAN1
Gene alias: DKFZp666E058
Gene description: N-terminal asparagine amidase
Genbank accession: NM_173474.2
Immunogen: NTAN1 (NP_775745.1, 1 a.a. ~ 310 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKISSPGS
Protein accession: NP_775745.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00123803-B01-13-15-1.jpg
Application image note: Western Blot analysis of NTAN1 expression in transfected 293T cell line (H00123803-T01) by NTAN1 MaxPab polyclonal antibody.

Lane 1: NTAN1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NTAN1 MaxPab mouse polyclonal antibody (B01) now

Add to cart