Brand: | Abnova |
Reference: | H00123688-M01 |
Product name: | HYKK monoclonal antibody (M01), clone 4F2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HYKK. |
Clone: | 4F2 |
Isotype: | IgG1 Kappa |
Gene id: | 123688 |
Gene name: | HYKK |
Gene alias: | AGPHD1 |
Gene description: | hydroxylysine kinase |
Genbank accession: | ENST00000360519 |
Immunogen: | HYKK (ENSP00000353710, 1 a.a. ~ 172 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQEGKPRVTPLLAKN |
Protein accession: | ENSP00000353710 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HYKK monoclonal antibody (M01), clone 4F2. Western Blot analysis of HYKK expression in human lung cancer. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |