H00123228-D01P_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00123228-D01P |
Product name: | SENP8 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SENP8 protein. |
Gene id: | 123228 |
Gene name: | SENP8 |
Gene alias: | DEN1|HsT17512|NEDP1|PRSC2 |
Gene description: | SUMO/sentrin specific peptidase family member 8 |
Genbank accession: | NM_145204.2 |
Immunogen: | SENP8 (NP_660205.2, 1 a.a. ~ 212 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK |
Protein accession: | NP_660205.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T01) by SENP8 MaxPab polyclonal antibody. Lane 1: SENP8 transfected lysate(24.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |