Brand: | Abnova |
Reference: | H00122622-M01 |
Product name: | ADSSL1 monoclonal antibody (M01), clone 2D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADSSL1. |
Clone: | 2D12 |
Isotype: | IgG1 Kappa |
Gene id: | 122622 |
Gene name: | ADSSL1 |
Gene alias: | FLJ38602 |
Gene description: | adenylosuccinate synthase like 1 |
Genbank accession: | NM_152328 |
Immunogen: | ADSSL1 (NP_689541.1, 369 a.a. ~ 436 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENH |
Protein accession: | NP_689541.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ADSSL1 monoclonal antibody (M01), clone 2D12. Western Blot analysis of ADSSL1 expression in A-431. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |