Cart 182 Product Products 76 839,00 € (empty)
No products
To be determined Shipping
76 839,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 182 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 76 839,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 76 839,00 €
Data sheet of CSNK1A1L purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CSNK1A1L purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00122011-B03P |
| Product name: | CSNK1A1L purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CSNK1A1L protein. |
| Gene id: | 122011 |
| Gene name: | CSNK1A1L |
| Gene alias: | MGC33182|RP11-532O21.2 |
| Gene description: | casein kinase 1, alpha 1-like |
| Genbank accession: | NM_145203 |
| Immunogen: | CSNK1A1L (NP_660204.1, 1 a.a. ~ 337 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN |
| Protein accession: | NP_660204.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CSNK1A1L expression in transfected 293T cell line (H00122011-T05) by CSNK1A1L MaxPab polyclonal antibody. Lane 1: CSNK1A1L transfected lysate(39.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |