SPPL3 polyclonal antibody (A01) View larger

SPPL3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPPL3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about SPPL3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00121665-A01
Product name: SPPL3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SPPL3.
Gene id: 121665
Gene name: UNQ1887
Gene alias: DKFZp586C1324|IMP2|MDHV1887|MGC126674|MGC126676|MGC90402|PRO4332|PSL4|SPPL3
Gene description: signal peptide peptidase 3
Genbank accession: NM_139015
Immunogen: SPPL3 (NP_620584, 212 a.a. ~ 262 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGS
Protein accession: NP_620584
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00121665-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00121665-A01-2-A5-1.jpg
Application image note: SPPL3 polyclonal antibody (A01), Lot # 060516JCS1. Western Blot analysis of SPPL3 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPPL3 polyclonal antibody (A01) now

Add to cart