Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NEDD1 monoclonal antibody (M05), clone 7D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about NEDD1 monoclonal antibody (M05), clone 7D10
| Brand: | Abnova |
| Reference: | H00121441-M05 |
| Product name: | NEDD1 monoclonal antibody (M05), clone 7D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEDD1. |
| Clone: | 7D10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 121441 |
| Gene name: | NEDD1 |
| Gene alias: | FLJ35902|GCP-WD|TUBGCP7 |
| Gene description: | neural precursor cell expressed, developmentally down-regulated 1 |
| Genbank accession: | NM_152905 |
| Immunogen: | NEDD1 (NP_690869, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF |
| Protein accession: | NP_690869 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.75 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The dynamics of microtubule minus ends in the human mitotic spindle.Lecland N, Luders J. Nat Cell Biol. 2014 Jun 29. doi: 10.1038/ncb2996. |