SP7 (Human) Recombinant Protein (P01) View larger

SP7 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP7 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about SP7 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00121340-P01
Product name: SP7 (Human) Recombinant Protein (P01)
Product description: Human SP7 full-length ORF (ABZ92092.1, 1 a.a. - 431 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 121340
Gene name: SP7
Gene alias: MGC126598|OSX|osterix
Gene description: Sp7 transcription factor
Genbank accession: EU446563.1
Immunogen sequence/protein sequence: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLLCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSPEQSNLLEI
Protein accession: ABZ92092.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00121340-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SP7 (Human) Recombinant Protein (P01) now

Add to cart